PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_70929.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 175aa    MW: 19611.4 Da    PI: 10.2492
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_70929.2genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1713.8e-53301581128
           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.. 95 
                   lppGfrFhPtd+elvv+yL++kv+g++ ++  +i+evd+yk++PwdLp+++  +++ewyfF++rd+ky++g+r+nr++ +gyWkatg dk+v  +  
  MLOC_70929.2  30 LPPGFRFHPTDDELVVHYLCRKVAGQPQPV-PIIAEVDLYKFNPWDLPERALFGSREWYFFTPRDRKYPNGSRPNRSAGTGYWKATGADKPVAPRes 125
                   79*************************999.88***************8777899*************************************99877 PP

           NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                   +g++vg+kk Lvfy+grap+g+ktdW+mheyr+
  MLOC_70929.2 126 GGRTVGIKKALVFYSGRAPRGVKTDWIMHEYRI 158
                   8999***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-6026163IPR003441NAC domain
PROSITE profilePS5100556.97430175IPR003441NAC domain
PfamPF023657.8E-2831158IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MMTAMVKAEA MTAEAEGSSG RRDAEAELNL PPGFRFHPTD DELVVHYLCR KVAGQPQPVP  60
IIAEVDLYKF NPWDLPERAL FGSREWYFFT PRDRKYPNGS RPNRSAGTGY WKATGADKPV  120
APRESGGRTV GIKKALVFYS GRAPRGVKTD WIMHEYRIAQ ADRTPGKKGS LKVIK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-88171582140Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3649580.0AK364958.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2029L14.
GenBankAM5008530.0AM500853.1 Hordeum vulgare subsp. vulgare mRNA for putative NAC transcription factor (nac4 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003564478.11e-107PREDICTED: NAC domain-containing protein 68-like
SwissprotQ52QH42e-97NAC68_ORYSJ; NAC domain-containing protein 68
TrEMBLM0YMU91e-128M0YMU9_HORVD; Uncharacterized protein
STRINGMLOC_70929.11e-125(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63790.12e-76NAC domain containing protein 102